SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166368680|ref|YP_001660953.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368680|ref|YP_001660953.1|
Domain Number 1 Region: 302-359
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 0.00000353
Family TonB 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166368680|ref|YP_001660953.1|
Sequence length 504
Comment hypothetical protein MAE_59390 [Microcystis aeruginosa NIES-843]
Sequence
MTSSYFGLETEENKLINSNNLSFAASLGIHGLILAIILPNFLNNPAQEPKKDLRNVNLIE
LNSLEQSRLPSLDSSLSSLPELPNPNLSSSSLPPLPPMDGIHNSTLPPLPSVSSLPPLPS
LPALPPLSSLPSVNIYSPPVASIPSLGRLPIPRNFPTSTPSLPSPPAVPTLPDNDNLPRE
TNNNRIPPYFDPYQDNLTLDRLRNSPLSASQQAQQQLNNSLARTPEPNGQSPLDEQRRQQ
LMWEMRERLRSLEADKSNTSNEEAMRNNLAWLARVQKTNPNALNELNQPNQGSRGITTVN
LTGNYPATACSRQLAGTAVYGVTVDAQGRLSSEPQLIKSAGFPIFNQQAAREVSLTRFNN
PSGASRSYHVRVSFAPNPEVCRGAIANPPKPEGSNLNTRNSPPVTPAIETPLRPNQPPQP
AVSPQPDNVKPPETTGPNPPQTQPEPPKEAIIEQKAPETPPQTPALNQPEGSPASPPTSQ
NPQPLSEEALPPGPPAEAKTEPES
Download sequence
Identical sequences B0JJ53
WP_012268121.1.4043 gi|166368680|ref|YP_001660953.1| 449447.MAE_59390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]