SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166368749|ref|YP_001661022.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368749|ref|YP_001661022.1|
Domain Number 1 Region: 9-176
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.27e-19
Family Leech intramolecular trans-sialidase, N-terminal domain 0.067
Further Details:      
 
Weak hits

Sequence:  gi|166368749|ref|YP_001661022.1|
Domain Number - Region: 294-401
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.000541
Family Serine carboxypeptidase-like 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166368749|ref|YP_001661022.1|
Sequence length 654
Comment hypothetical protein MAE_60080 [Microcystis aeruginosa NIES-843]
Sequence
MDLSHGFLDIDQSITITFWAKGENNLATETTLLEAVNRENNRVLHITLPWGDPVKPAIFW
DAGNEEGFDRIEKKVKLKDYSDWTHWAFVKNATTGRMLIYRNGIIWHRGNGHNRALTGIE
KIILGASVNLSHYWQGCLAELSVWNQARSQEEIQKAMYQSPLVDDLGLVTYLSLNGSAED
QTSYSNHGILYGTTWQLDSLPSKPTSIPKSKTQTSSKARRSAKRITMVNEIFNSLEEEEV
IEQDAPSENQEPSREENPESIIIAAEAALASNEIEEISETAISQPDILTYSNQKKRLIIC
CDGSWEDSASAYPTNVVKFAESIKYIAEDQTPQIVFLSGSGTPEDNEFIKSLGNETFGWG
LDRMIQDAYRFLVLNYNPTTEDEIYLLGFSRGAYIVRCLASFIDKCGILKRSKIKEIPLA
YQLYRDHTVSSDSAKAQQFRAANAKKIETEKEDFQDRIPVKMLGCWDTVGNFGIPDLTPW
FPLAKFYHKKYEFSNTKLSPIIQNAFHAVAIDEKRKNFPYTPIKANPENPEQVVKEVLFV
GEHTCLGGGKKEYQGLSDYPLQWMINQAKKLGLEFDSTTSESEEFQIKLDPTIKFDNTVK
GLSALGGEQWRYFNTKVVTVHHSVVKRLKAFSDYRPKSLEPFLQALLDDDQQTD
Download sequence
Identical sequences B0JJX6
449447.MAE_60080 gi|166368749|ref|YP_001661022.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]