SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166368759|ref|YP_001661032.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368759|ref|YP_001661032.1|
Domain Number 1 Region: 47-577
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 2.29e-123
Family Arylsulfatase 0.00000304
Further Details:      
 
Domain Number 2 Region: 592-760
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000215
Family Laminin G-like module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166368759|ref|YP_001661032.1|
Sequence length 789
Comment arylsulfatase like [Microcystis aeruginosa NIES-843]
Sequence
MSQDKPIQRQILPIPDLTPFGLTTYDAKNPDTDYPPIRDIRPPAGAPNVLIVLLDDVGFG
ASSAFGGPCNTPTFERLAAQGLKYTRFHTTALCSPSRAALLSGRNHHSVGMGNITETATS
APGQSSVRPNTKAPLALTLKLNGYSTAQFGKCHEVPVWQTSPIGPFDAWPSGGGGFEYFY
GFIGGENNQWEPALYEGTTPIEPPKTPEEGYHLTEDLADRAIAWVSQQKALAPDKPFFMY
FAPGATHAPHHVPKEWIDKYRGQFAHGWDHQREITFARQKELDVIPQNAELTPRHAEIPA
WDDMDDRLKPVLERQMEVYAAFLEHTDEQVGRVIQALENLEILDDTLVYVIIGDNGASAE
GTLQGAFNEMANFNGLAGLETPEFLLSKLDDFGAPDSYNHYAVGWAWAMSSPYKWTKQVA
SHWGGTRNGTIVRYPKIITEKGGIRHQFCHLIDVAPTVLAVAGIPEPTMVNGVLQSPYEG
TNMVYTFNDAAAPERHDVQYFEMFGNRGIYYKGWSAITKHRTPWIMTGQTMVPFDDDIWE
LYDGSTDGTQARDLSREMPEKLHELQRQFLIEAVKYNVLPLDDRQVERVDPATAGRPTLV
RGNSQLFFAGMGRLSENSVINIKNKSFSVTAELNIPPEGADGVIIAQGGRFGGWSVYTHD
GKAKFVYNVLGIQSFVTEATETIPAGKHQVRMEFAYDGGGLGRGGNVTLYYDGQLVGTGR
VERTQAFIFSADETTDIGYESGTPVAAEYTSKTSRFTGKIGWVQLDVGTDAHDHLIDQEE
RLKIIMARQ
Download sequence
Identical sequences B0JJY6 I4HP84
449447.MAE_60180 gi|166368759|ref|YP_001661032.1| WP_002796624.1.4043 WP_002796624.1.50331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]