SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166368790|ref|YP_001661063.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368790|ref|YP_001661063.1|
Domain Number 1 Region: 593-700
Classification Level Classification E-value
Superfamily CalX-like 8.5e-24
Family CalX-beta domain 0.0037
Further Details:      
 
Domain Number 2 Region: 365-476
Classification Level Classification E-value
Superfamily CalX-like 1.29e-20
Family CalX-beta domain 0.0037
Further Details:      
 
Domain Number 3 Region: 478-589
Classification Level Classification E-value
Superfamily CalX-like 1.83e-20
Family CalX-beta domain 0.0025
Further Details:      
 
Domain Number 4 Region: 144-333
Classification Level Classification E-value
Superfamily beta-Roll 6.54e-19
Family Serralysin-like metalloprotease, C-terminal domain 0.0018
Further Details:      
 
Domain Number 5 Region: 15-175
Classification Level Classification E-value
Superfamily beta-Roll 1.36e-18
Family Serralysin-like metalloprotease, C-terminal domain 0.0017
Further Details:      
 
Domain Number 6 Region: 709-816
Classification Level Classification E-value
Superfamily beta-Roll 0.0000000392
Family Serralysin-like metalloprotease, C-terminal domain 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166368790|ref|YP_001661063.1|
Sequence length 894
Comment hemolysin-type calcium-binding protein [Microcystis aeruginosa NIES-843]
Sequence
MTYNTATGSGTITVGTETDTFTSIESFDGFKGTEYNDVIFGGTASEYWGALSGGGGNDTI
SGNAGFDYIYGENGNDVLNGGDDSDYLYGGDGNDVLNGGAGSDNILGGNGNDLLNGDAGD
DYFTGDEGDNDTINGGAGSDSYAADYSYGSSGLTMTYDTAGSGTITVGTETDTFTSIESF
NGFKGTDYNDVIFGGTRVYYYETLYGGSGNDTISGNAGGDYIYGENGNDVLNGGDGYDDL
YGGNGNDTLQGTDGGTGEYDDLVGGSGNDRFILADTTKTFYDDGLTATEGTSDYATIADF
STIDDIIQLRGSSSDYLLTVSGSTTKLYINKPGNEADELIAYISNQTALSLTASYFSYVS
SPTLPSITLAVSPASVTEDGTTNLVYTFTRTGVTTDALTVNYTVSGTATNGTDYASIPTS
VTFAAGSSTATVTVDPTADTTVESDETVILTLAAGTGYTIGTTTPVTGTITNDDLILPSI
TLAISPSSVTEDGTSNLIYIFIRTGDTTNPLTVNYSIGGTATNGTDYTLLPTSVTFEANS
AIATVTVDPTADTIVESDETVILALAAGTGYTVGTPNAATGTINNDDTSVTSQLSINDIT
VVEGKDNNAILTVTVDNPNPQPITFNYTTAPINATANVDYTSKTGTITIAPNTATATISI
PLLNDNLNEPDEVFTVTLSNPVNATVNPDEAIGQVIITDTLQSAITRTLPNNVENLRLIG
TNNINGTGNAGNNKITGNSGNNQINGRAGIDTLTGGLGADTFIFQFGQSTISTSDRITDF
AINSDKIDLLTQGGLPMSAPSSFSRAANSTVTTLQNLVNQVFTDANGATTGNQELAVNSA
ALVQVTTGAIAGTYLVINDSTDGFQSSNDLLMNITGFTGTLPALGSIPVGNFFV
Download sequence
Identical sequences B0JK17
gi|166368790|ref|YP_001661063.1| WP_012268208.1.4043 449447.MAE_60490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]