SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166368846|ref|YP_001661119.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368846|ref|YP_001661119.1|
Domain Number 1 Region: 1-112
Classification Level Classification E-value
Superfamily XisI-like 1.57e-39
Family XisI-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166368846|ref|YP_001661119.1|
Sequence length 112
Comment FdxN element excision controlling factor protein [Microcystis aeruginosa NIES-843]
Sequence
MDTRLKYQGIIKTVLQNHANYRATLPDGYTSQVIFDDERGHYLVLDFGWSGNKYLHATPI
HLSLVVDKVWIQCDETEEGIATDLMEAGIPKEDIVLGFRYPKVRKYTGFAVA
Download sequence
Identical sequences A0A0A1VRC7 A0A1V4BWX3 B0JK73
gi|166368846|ref|YP_001661119.1| WP_012268251.1.10452 WP_012268251.1.4043 WP_012268251.1.79847 449447.MAE_61050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]