SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166368910|ref|YP_001661183.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368910|ref|YP_001661183.1|
Domain Number 1 Region: 10-225
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 5.14e-77
Family D-ribulose-5-phosphate 3-epimerase 0.0000000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166368910|ref|YP_001661183.1|
Sequence length 235
Comment ribulose-phosphate 3-epimerase [Microcystis aeruginosa NIES-843]
Sequence
MTQNGSSKSIVVSPSILSADFSKLGADIEAVDKAGADWIHVDVMDGRFVPNITIGPLIVS
AIRPYTKKPLDVHLMIVEPEKYVADFAKAGADIISVHAEHNASPHLHRTLCQIRELGKQA
GVVLNPSTPLDLIEYVLHLCDLVLIMSVNPGFGGQSFIPEVVPKILQLRQMCDERGLDPW
IEVDGGLKPANTWQVLEAGANAIVAGSAVFNAPDYATAIEGIRNSKRPQPQLATV
Download sequence
Identical sequences B0JKD7 I4HSZ3
449447.MAE_61690 gi|166368910|ref|YP_001661183.1| WP_002797282.1.4043 WP_002797282.1.50331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]