SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166368923|ref|YP_001661196.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368923|ref|YP_001661196.1|
Domain Number 1 Region: 12-274
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.71e-45
Family TK-like PP module 0.002
Further Details:      
 
Domain Number 2 Region: 299-487
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.58e-29
Family TK-like Pyr module 0.05
Further Details:      
 
Domain Number 3 Region: 503-632
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.57e-21
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166368923|ref|YP_001661196.1|
Sequence length 633
Comment transketolase [Microcystis aeruginosa NIES-843]
Sequence
MTAFPIDLSAYKPISLDPSNPTLTDHQRSTLKANIQLCRDAIIFFTATGAARGVGGHTGG
PYDTVPEVVILDALFRSQPSQFVPIFFDEAGHRVGTQYLMSALEGSLPPEQLMHYREANS
KLPGHPELGLTPGVKFSSGRLGHMWPYVNGVALANPGKTVFCLGSDGSQQEGNDAEAARL
AVAQHINVKLIIDDNDVTIAGNPSKYLPGYDVAKTLAGHGLKVLVGDGEDIDSLYRNICE
AINTPGPIAIINKRPMCPGIEGLEGSNHGHDVISVPLALKYLEAKGHSAAVEYLNSIKKP
SNDYKFLGSGDKWGSNRNVFGEAVVSLLGKMSEEERKAKVLVVDSDLEGSCGLKIIHDKH
PEVFIPSGIMERGNLSAAAGFGMEKGKQGIFATFAAFLEMCISEITMARLNYSNLLCHFS
HSGIDDMADNTCHFGLNNFFADNGLDDGYETRLYFPADAAQMTACVEATFHQPGLRFIFS
TRSKTPNILDTNVHNFFGDGYTFVPGKDEVIREGTAGYIISFGDGLYRALDAVERLKQEG
IDVGLINKPTLNVVDEEIIAKVGNSPFVLVVEAFNRRTGLGSRYGSWLLERGLTPKYAYI
GTHHEGCGGLWEQFPHQGIDPVGIISKVKSLIA
Download sequence
Identical sequences B0JKF0
WP_012268303.1.4043 449447.MAE_61820 gi|166368923|ref|YP_001661196.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]