SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166368941|ref|YP_001661214.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368941|ref|YP_001661214.1|
Domain Number 1 Region: 172-487
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.22e-113
Family Leucine aminopeptidase, C-terminal domain 0.000000408
Further Details:      
 
Domain Number 2 Region: 1-175
Classification Level Classification E-value
Superfamily Macro domain-like 4e-31
Family Leucine aminopeptidase (Aminopeptidase A), N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166368941|ref|YP_001661214.1|
Sequence length 490
Comment leucyl aminopeptidase [Microcystis aeruginosa NIES-843]
Sequence
MDIRSTDTSLLTWTGDTLALGLPEGAIEIAGELAELNDKLGGNLGDLISETEFEGKLGSS
AATRLGGGPIRKLILVGLGKTADFDLQTLRLAAAAIARLAKQQKSQALAISLPVVGDQSA
TAGAITEGLLLATHQDTRFKSTKEEKGAKLETVELLGLGEQASAIAKSEQICSGVILARE
LVNAPANTVTPLTMAETAEQIAAEYGLSLNILEQEECESLGMGAFLGVAKASDIPPKFLH
LIYKPQGTPKRKLAIVGKSLTFDSGGLNIKGAGSGIETMKMDMGGGAATLGAAKAIAQLQ
PEVEVHFICPATENMISGRAMHPGDILTASNGKTIEVNNTDAEGRLTLADGLVFAEKLEV
DAIVDLATLTGACVIALGDDIAGLWSSDESLAAQIQEAAKLAGEKFWPMPLEEKYFEGMK
SQIADMKNTGPRPGGSITAALFLKQFINNTPWLHLDIAGPVWSDKENGVNNSGATGFPVR
TLVNWVMANN
Download sequence
Identical sequences B0JL23
WP_012268315.1.4043 449447.MAE_62000 gi|166368941|ref|YP_001661214.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]