SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166368963|ref|YP_001661236.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|166368963|ref|YP_001661236.1|
Domain Number - Region: 31-201
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000213
Family CBM4/9 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166368963|ref|YP_001661236.1|
Sequence length 246
Comment hypothetical protein MAE_62220 [Microcystis aeruginosa NIES-843]
Sequence
MELKSCSQVTTIALGISSSILFTVSFVSPASAVNLIINGSFEEGDYDSNVVDPNFARLSQ
GSSALTGWTIGGAGVDWHNSNDMKFPIEGDLIIDLNLDGGSSGTLSQTFSTIIGQFYTLS
FSLAGPDLSATNPSFPNPRQVSVQVAAVNQIFSTSASDHLDLQWQLHELSFQATGNQTTL
TFSSLDNSGFWGPALDNVTVVSNAESVPEPSSILSILALGTLGAASTLKRQFKSSKSTEK
ETTKVS
Download sequence
Identical sequences A0A1V4BWL5 B0JL45
gi|166368963|ref|YP_001661236.1| 449447.MAE_62220 WP_012268334.1.4043 WP_012268334.1.79847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]