SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166368981|ref|YP_001661254.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368981|ref|YP_001661254.1|
Domain Number 1 Region: 7-196
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.45e-32
Family FAD/NAD-linked reductases, N-terminal and central domains 0.018
Further Details:      
 
Domain Number 2 Region: 156-316
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.3e-18
Family FAD/NAD-linked reductases, N-terminal and central domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166368981|ref|YP_001661254.1|
Sequence length 420
Comment type 2 NADH dehydrogenase [Microcystis aeruginosa NIES-843]
Sequence
MNKPITKICILGGGFGGLYTALDLSRLTAVKSGQWQITLVEPKDHFLFTPLLYELITGEL
QRWEIAPSYRQLLTGTKVNLKTQKASNIDLNNHRVYLENEEVIDYDYLVLAVGVRNRWPA
IPGLADYGLTFRSLEDVEKLQTAIHDLETQGKSSINLAIIGGGPNGVELACKVADGLGKK
GKVHLVEKNEEILQNFPKSVRVASYRSLLAKNVSLYLNTGLKEVAANSITVFKDNTNEVI
PIDLLLWTAGTQAQDWINNLDCQKTAQGKLLTRSSLQLIDYPEVFALGDLAEIYPSKQVV
PATAQAAYQAASVVAKNISAVIRKKSLKPYYYLHLGDMLTLGKQSALVSSFGINITGRLA
DIMRRFVYILRLPSKRHQLKVFRHWAKKILLRLRYSQVLSNTKSVEYRLHIRRGKRQKGE
Download sequence
Identical sequences B0JL63
449447.MAE_62400 WP_012268345.1.4043 gi|166368981|ref|YP_001661254.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]