SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166369006|ref|YP_001661279.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166369006|ref|YP_001661279.1|
Domain Number 1 Region: 2-350
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.77e-74
Family TK-like PP module 0.011
Further Details:      
 
Domain Number 2 Region: 290-480
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.47e-66
Family TK-like Pyr module 0.01
Further Details:      
 
Domain Number 3 Region: 494-624
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 3.14e-37
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166369006|ref|YP_001661279.1|
Sequence length 636
Comment 1-deoxy-D-xylulose-5-phosphate synthase [Microcystis aeruginosa NIES-843]
Sequence
MHLSEITHPNQLHGLSLRQLEDIARQIREKHLQTIAATGGHLGPGLGVVELTIALYQTLD
LDRDKVLWDVGHQAYPHKLLTGRYNDFHTLRQKDGIAGYLKRCESKFDHFGAGHASTSIS
AGLGMALARDAKGEDFKVVSIIGDGALTGGMALEAINHAGHLPNTNIMVILNDNEMSISP
NVGAISRYLNKVRLSEPVQFIADNLEEQFKNLPFFGDSLTPEMERVKEGMKRLAVPKVGA
VIEELGFKYFGPIDGHNIPELIATFKQAHKVHGPVFVHVATVKGKGYEWAEKDQVGYHAQ
NPFNLATGKPIPSSKPKPPAYSKVFGHTLTKLAENDPRIIGITAAMATGTGLDKFQAKLP
KQYIDVGIAEQHAVTLAGGLACEGMRPVVTIYSTFLQRAFDQIIHDICIQNLPVFFCMDR
AGIVGADGPTHQGMYDIAYLRCIPNMTIMAPKDEAELQRMVVTGINHTSGPIAMRYPRGN
GLGVPLMEEGWEALPIGKGEILRSGDDILLLGYGTMVNTSLQVAEILSEHGIEATVVNAR
FVKPLDTELIFPLAQRLGKVVTLEEGCLMGGFGSAVLEALQDANILVPVKRFGVPDKLVD
HATPEESFADLGLTSPQIAQQVLAAFFSQKQTANVG
Download sequence
Identical sequences B0JL88
gi|166369006|ref|YP_001661279.1| 449447.MAE_62650 WP_012268365.1.4043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]