SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166369051|ref|YP_001661324.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166369051|ref|YP_001661324.1|
Domain Number 1 Region: 149-303
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.25e-29
Family CBM11 0.049
Further Details:      
 
Domain Number 2 Region: 59-145
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.000000000238
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166369051|ref|YP_001661324.1|
Sequence length 364
Comment hypothetical protein MAE_63100 [Microcystis aeruginosa NIES-843]
Sequence
MSTVPFEERKVMAESKSWDFQRFWQTLDYFDSIPLWSCLQKLLGFGEDKKNQLTNEQGMK
TILVIGGENAIGRKVITQLQQQNYQIRALVDNIESARQLLAENVDLFALQTPQLFTGIER
IIYCQGENNRHSLANLLDLLKNAGITAEKTLFDFSNPSSDIKEIWGAVDDVVMGGVSESQ
ITLTGGRALFSGIVRTENNGGFASVRTRNLNPPLNLSNYEGIELQVQGDGKRYKLILRCE
GRWDGIGYCYSFDTFDRTWQTISIPFGDLIPVVRAKTMREAAPFDSSSVYALQLMQSKFE
YDGAINPRFSPGLFALEIVTIKAYGGKNRLIIVKEGEIAEKSLLDASGYPYEAIDSAQIF
AKLN
Download sequence
Identical sequences B0JLD3
gi|166369051|ref|YP_001661324.1| 449447.MAE_63100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]