SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166363845|ref|YP_001656118.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166363845|ref|YP_001656118.1|
Domain Number 1 Region: 1-164
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.96e-42
Family TK-like Pyr module 0.0083
Further Details:      
 
Domain Number 2 Region: 171-300
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 5.5e-20
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166363845|ref|YP_001656118.1|
Sequence length 303
Comment transketolase [Microcystis aeruginosa NIES-843]
Sequence
MRNAFSDALVKFALGDERVLLLTGDHGYALFDDFRQACPKQYINAGVAEQNMVGVAAGLA
KSGFFPVVYGLSSFLPIRVLEQIKLDICYEQLKVLLIGDGAGVVYSSLGSSHQSTEDIAA
LRALPNISILSPADASEMTQCLNWAFNSDRPVYLRMGKADLGVIHETLPNLEPGKLYPVK
PGTGNLGFLATGSMVKTALEVAQEWDNSGVWSVPFIKPLDVQQVREICQQYQAIVVIEEH
SIYGGLGAAISEIASTYHPSWICRIGIEDRFSQFCGTYQYLMQEHRLDVTSVKEKVRNFM
SRL
Download sequence
Identical sequences B0JSN2
gi|166363845|ref|YP_001656118.1| WP_012264579.1.4043 449447.MAE_11040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]