SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166363993|ref|YP_001656266.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166363993|ref|YP_001656266.1|
Domain Number 1 Region: 2-148
Classification Level Classification E-value
Superfamily beta-Roll 3.77e-34
Family Serralysin-like metalloprotease, C-terminal domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166363993|ref|YP_001656266.1|
Sequence length 182
Comment calcium-binding protein [Microcystis aeruginosa NIES-843]
Sequence
MYGNEGNDSIYGQGGNDYIDGGIGNDYIDGGDGADIIFGRAGNDNVFGGNGSDLLIGEAG
ADTLSGGNDTDYLFGGADNDVLLGGAGNDFVYGGYGNDILTGGTGADAFFFGSLLEGVDV
IKDFQWIEGDVIQLSKSGFNASSLSQFNYNSLTGGLSFLGQQFATIENRPAGFAVSLDVQ
LI
Download sequence
Identical sequences B0JT30
gi|166363993|ref|YP_001656266.1| 449447.MAE_12520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]