SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166364474|ref|YP_001656747.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166364474|ref|YP_001656747.1|
Domain Number 1 Region: 794-908
Classification Level Classification E-value
Superfamily CalX-like 3.79e-32
Family CalX-beta domain 0.00071
Further Details:      
 
Domain Number 2 Region: 914-1020
Classification Level Classification E-value
Superfamily beta-Roll 2.09e-19
Family Serralysin-like metalloprotease, C-terminal domain 0.00021
Further Details:      
 
Domain Number 3 Region: 681-768
Classification Level Classification E-value
Superfamily Hypothetical protein PA1324 0.000000000000523
Family Hypothetical protein PA1324 0.014
Further Details:      
 
Domain Number 4 Region: 314-391
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000162
Family Proprotein convertase P-domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166364474|ref|YP_001656747.1|
Sequence length 1107
Comment hypothetical protein MAE_17330 [Microcystis aeruginosa NIES-843]
Sequence
MTNLLQTTLNKTYNQLKNFAGLNDFWNLFEIAFGTQYDHTVATNLRSQWLVGDFSSFPQI
EILDSSILGNASGAYGTSTNKIYLAANFLDTATETDIIAVLLEEYGHFIDAHINQTDSAG
DEGDIFSNLVRGNSLSAGTLQALKGENDHATITLDGQSIEIEQGVIQLPDLTAGSPALLT
WADNLNRYQYENVRTIGGGYRARFKNTFLPGPILNPFPNPIPAGIPPLSTVATTINELPS
TEKGLLIHTAGTDHVFGSSSPWTPWSPTTGFSNITNATNFIQTIALSPTGNTRHIFAEDT
YNSTVGTPINVGILRYTGVGGVKVTLDWTGPASNNLDVYLTNTLGGSPSYTPSFIGTETT
VTNDNIEQIFSTTIPAGNYYIYVTKNSTVTTPFIQDFSIFATANNPVNQGHGWGDVHLVN
FDGKPYDFQAVGEFILVKSLIDDFQVQTRQKPWGASTTVSVNTAFATTIDGYNVVYDSEL
AVGQELKIDGVTYNLASGQSVFLSSSKIQRSGNQYTFTYAGLDGDLSTADDNDVIIASDN
GSYIDVYVDPADYRFGVLQGLLGNGDGVSTNDFALRDGTDLGPNPSVQTIHTTYADSWRI
TQQESLFGTPTFANKSFPANYVSLETLAQQNPQGVANAFAKGREFGIAEGAFLNGGVFDF
VVTGDEGFLKGAKLAANLALKNGDIQIPLGSIQGSKWNDANANGIWDTGEKALAGWTIYI
DSVANGKLDPWELSTVTNADGQYTFSNLGPGEYAIREVNQTGWIQTFPTTPYALNLKAGE
KLTGINFGNYFQLPTINLSPSNQTVVEGLTTPQNASYTVTLSQASNQTVSVNYATSNGTA
TAGADYTATTGTLTFAPGVTTQVINIPILNDSLNEADETFTLALSSPTNAVLGAVTIATT
TITDTITAAVTTTLAANVENLTLTGAAAINGTGNAGNNVITGNTANNLLNGGGGNDTLNG
GAGIDTLTGGTGNDIFLFQFSQSTVANPDRITDFAINSDKIDLLSAAGGVLPAPAAFSRA
ANSAAATLTNVVNAVFTDANGALAGNQALGINGAALVQVTTAGIAGTYIIVNDNVAGFQS
ANDLLVNVTGITGTLPTGNIPVSNFFV
Download sequence
Identical sequences B0JW75
449447.MAE_17330 WP_012265060.1.4043 gi|166364474|ref|YP_001656747.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]