SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166365040|ref|YP_001657313.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166365040|ref|YP_001657313.1|
Domain Number 1 Region: 300-413
Classification Level Classification E-value
Superfamily beta-Roll 7.33e-29
Family Serralysin-like metalloprotease, C-terminal domain 0.00043
Further Details:      
 
Domain Number 2 Region: 2-20,48-135
Classification Level Classification E-value
Superfamily beta-Roll 0.0000000000000119
Family Serralysin-like metalloprotease, C-terminal domain 0.0019
Further Details:      
 
Domain Number 3 Region: 146-285
Classification Level Classification E-value
Superfamily beta-Roll 0.000000000445
Family Serralysin-like metalloprotease, C-terminal domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166365040|ref|YP_001657313.1|
Sequence length 445
Comment hypothetical protein MAE_22990 [Microcystis aeruginosa NIES-843]
Sequence
MDGGDGNDTYFVDNVGDIVKEVFDDAPGGTADTVLASVSYSLAPGTFGNQGYGIENLTLT
GFGNINATGNSKNNILTGNIRNNVLNGGLGNDTINGGLGNDTLDGGVGVDSMDGGDGNDT
YFVDNVGDIVKEVFDDAPGGTADTVLASVSYSLAPGTFGNQGYGIENLTLTGFGNINATG
NSKNNILTGNASANTFFGTAGNDTINGGAGFDTANYSALSNVVTLGAFGVLNKGALGTDT
LIAVESIVGSSLLGDTVDHSGASVALATGRVTNLATGVVTVNGTAAPLPLTFQVSQFENV
IGSSFADTITGNSDNNILNGGAGNDSINGGAGNDSINGGAGNDSINGGAGNDTLIGGAGN
DTLTGDAGADKFRFNFLSEKVDTIQDFSRPEGDKIEVSKSGFGATSLSQISYNAGTGSLS
FLGTEFAKIANLPAGFAVSLDVVLI
Download sequence
Identical sequences B0JGB6
449447.MAE_22990 WP_012265472.1.4043 gi|166365040|ref|YP_001657313.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]