SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166366555|ref|YP_001658828.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166366555|ref|YP_001658828.1|
Domain Number 1 Region: 800-1177
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.36e-126
Family PFOR PP module 0.0000000131
Further Details:      
 
Domain Number 2 Region: 419-671
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.75e-83
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0000004
Further Details:      
 
Domain Number 3 Region: 5-259
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.06e-77
Family PFOR Pyr module 0.0000000694
Further Details:      
 
Domain Number 4 Region: 260-417
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 3.57e-48
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.00000587
Further Details:      
 
Domain Number 5 Region: 668-842
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 3.07e-24
Family Ferredoxin domains from multidomain proteins 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166366555|ref|YP_001658828.1|
Sequence length 1184
Comment pyruvate-flavodoxin oxidoreductase [Microcystis aeruginosa NIES-843]
Sequence
MTTKTYATIDGNEAVARVAYRLSEVIAIYPITPSSPMGEWSDSWAAERRANLWGTIPSVI
EMQSEGGAAGTLHGALQTGSLTTTFTSSQGLLLMLPNFYKIAGELTSSVVHVAARALAAQ
GLSIFGDHSDVMSARSTGWAMLAANSVQEAQDLAAIATATTLETRIPFLHFFDGFRTSHE
VQKVELISDETLKELIDEDLIIAHRQRALTPDRPVLRGTAQNPDVYFQARESVNPFYYAC
PDITQKIMDRFAQLTGRQYHLYEYHGAPDAERVIMLMGSGGETVHETVDYLNQNGAKVGV
LKVRLYRPFAAEKLLAALPTTVKKIAVLDRCKEPGAGGDPLYLDVVNAFMENYEGKLPKI
VGGRYGLSSKEFTPAMIAGIFDNLSLDKPKNHFTIGIVDDLTFSSLEYDRSFSTEPDEVV
RAVFYGLGSDGTVGANKNSIKIIGEDTDNYAQGYFVYDSKKSGSVTVSHLRFGPEPIRST
YLITDANFIACHQWEFIEQFDLLETAKPNSIFLLNSPYPQEEVFSHLPRHLQQTIIDKNL
QVYTINATQVAKEAGMGSRINTVMQVCFFALAGVLSREEAIAQIKKAIRKTYGKKGEEIV
QMNIKAVDSALEHLYQVPIPATVTPEAFELRPPIPDTAPAFVREVLGKIIARHGDELPVS
SLPNDGTYPTATSQWEKRNIAQEIPVWDADVCVQCGKCVLVCPHAVIRSKVYDEAELATA
PETFKVANAKDHDWKGLKFTIQVAAEDCTGCGLCVDVCPAKNKSQPRLRAINMAPQLPLR
EQERVNWDFFLNLPNPDRLSLNLNKINHQQMQEPLFEFSGACAGCGETPYVKLVSQLFGD
RMIVANATGCSSIYGGNLPTTPWAVNAEGRGPAWSNSLFEDNAEFGLGFRVSIDKQAEFA
AELLGTLASEIGESLAADILNCHQVDEAEIYEQRHRVEALKSRLGELTPTTQVKMLLSVA
DYLVKKSVWIVGGDGWAYDIGYGGLDHVLASGRNVNILVMDTEVYSNTGGQASKATPRAA
VAKFASGGKPGPKKDLGLMAMTYGNVYVASVAMGARNEQTIKAFLEAEAYNGPSLIIAYS
HCIAHGINMTTAMNHQKEVVESGRWLMYRYHPDLAKEGKNPLQLDSRAPKLTVAQTLYSE
NRFKMLATSKPEEAKRLLKEAQADVDTRWQMYQYLAAKGTGSNE
Download sequence
Identical sequences B0JPR2
449447.MAE_38140 WP_012266601.1.4043 gi|166366555|ref|YP_001658828.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]