SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|172060300|ref|YP_001807952.1| from Burkholderia ambifaria MC40-6

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|172060300|ref|YP_001807952.1|
Domain Number - Region: 57-141
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0137
Family alpha-D-mannose-specific plant lectins 0.0093
Further Details:      
 
Domain Number - Region: 26-65
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease catalytic domain-like 0.0518
Family tRNA-intron endonuclease catalytic domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|172060300|ref|YP_001807952.1|
Sequence length 148
Comment hypothetical protein BamMC406_1245 [Burkholderia ambifaria MC40-6]
Sequence
MPYIIQNVQGPAPLSVGERIWGDATEIDFGAMTSCIALVEQTPGKPASVRAIHLSIVSGD
GTPVYDPASNVAGQVGAIMQPTGNLRACLGRIEVWQGSESQQLRDFFAGLMQSLDMTTWV
PLPDGNLRVRFNGGVIQYREGSGAWIDV
Download sequence
Identical sequences B1YN22
WP_012363597.1.54386 gi|172060300|ref|YP_001807952.1| 398577.BamMC406_1245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]