SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|172059837|ref|YP_001807489.1| from Burkholderia ambifaria MC40-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|172059837|ref|YP_001807489.1|
Domain Number 1 Region: 207-535
Classification Level Classification E-value
Superfamily Subtilisin-like 1.57e-59
Family Serine-carboxyl proteinase, SCP 0.000000535
Further Details:      
 
Domain Number 2 Region: 34-190
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 1.68e-33
Family Subtilase propeptides/inhibitors 0.01
Further Details:      
 
Domain Number 3 Region: 552-656
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.44e-24
Family alpha-D-mannose-specific plant lectins 0.00029
Further Details:      
 
Domain Number 4 Region: 674-774
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.44e-22
Family alpha-D-mannose-specific plant lectins 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|172059837|ref|YP_001807489.1|
Sequence length 777
Comment peptidase S53 propeptide [Burkholderia ambifaria MC40-6]
Sequence
MVFALAGCGGDDSPTAAATNVAAQTGKVSALRATGNVVSAAPMSATAPIHVALVLKLNDE
AALHRFVQDARTPGSASFGAVLTSAQIAARYTPSAGQVATVKAYLQSKGFTNIDVAGNNM
IVEADAPAGVVSGVFQTTLVPVAMADGTSAHINTAPETMPDALGAVVQSVLGLDTATRVH
PHFVRASLSASAPQANASPTTAAVTVAHSPTDFPGIYSVGSTPTASNITVGIIAEGNLTQ
PVIDLATFASNHQLPAVPVSVINVGSPSADTSANTEWSLDSQTIVGMSGGVKQLNFYVAP
SFAWSNMALAINRAVTDNTARVVNMSIGGCENWAPTAAIDTLFELAVAQGQTFAVSSGDS
GSVAYGCSGTSVQYPATSPYVVAVGGTSLYTNGNGSYAGETAWDGSGGGISGIEPIPSWQ
SNVPALKGRFFRGMPDIAFDADPYSGAQVVVGGQLEIVGGTSLSAPLFAATWARMLSGGC
AASLGFAAPTLYSAQATTPSIFRDVTNGSNGAYSAGSGWDFVTGWGTPNVSALHSAICVP
TSPIYGGEVAEGTTLRPSQIVYSASGSHRLAMQDDGNLVLYNTANGAAVWSSRTNGNAGA
YGVFQTDGNFVIYSVSGKPLWSSSTNGTTFDQRLSVQDDGNMVIYRVSVPVFATSTSAAG
LPNSSSGPAVWNGGMTLSSGQSLTSGNGANVLVMQGDGNLVLLRQGVPQWSSRTYNHPGA
YAAMQPDGNLVVYSSSGAPLWYSGTSGNPGAVTYVQDDGNIVIYARIPNWSSNTAGS
Download sequence
Identical sequences B1YUE6
WP_012363238.1.54386 398577.BamMC406_0777 gi|172059837|ref|YP_001807489.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]