SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|470169544|ref|YP_007550430.1| from Azoarcus sp. KH32C

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470169544|ref|YP_007550430.1|
Domain Number 1 Region: 198-297
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.0000000000000666
Family RNA methyltransferase FtsJ 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|470169544|ref|YP_007550430.1|
Sequence length 368
Comment putative RNA 2'-O-ribose methyltransferase [Azoarcus sp. KH32C]
Sequence
MHPSPTQNRLPLSVYGLLALCRAGFEKEVATELEAFCAEIGMSGFVRAQPGQAFVTFESH
EAVDFAELAEHCDWRTLIFARQLLPWFARVDNLPERDRATPIVAAAREAGQRFASLMLET
PDTDEAKQQSGFCRRFTAPLQRELEKAGAFREGAKGLPELHVLFGDASTAWLCASLPGRA
ALWPMGIPRLRMLREAGSRSTLKLAEAIFTLLTEEERNAGLRAGLRAVDLGAAPGGWTWQ
LAHRGLRVTSIDNGPMAPSVMATGLVEHVRADGFTWRPQRPVEWMVCDMVEQPTRIAALV
ADWIATGRCRRTIFNLKLPMKKRLDAVEQCRAIITKRLVNEGPFVLRLKHLYHDREEITG
YLALRKSA
Download sequence
Identical sequences H0PYB2
gi|470169544|ref|YP_007550430.1| WP_015434761.1.10474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]