SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|470171915|ref|YP_007552801.1| from Azoarcus sp. KH32C

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470171915|ref|YP_007552801.1|
Domain Number 1 Region: 109-289,325-514
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 2.35e-75
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.00035
Further Details:      
 
Domain Number 2 Region: 10-101
Classification Level Classification E-value
Superfamily Cytochrome c 2.01e-16
Family N-terminal (heme c) domain of cytochrome cd1-nitrite reductase 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|470171915|ref|YP_007552801.1|
Sequence length 521
Comment cytochrome c-type [Azoarcus sp. KH32C]
Sequence
MRIPLPRATVAVLLVASAMPALAADAPVDIPALYQQHCAACHAPDRLGATGPALLPENLA
RLRKDEALAVVREGRPATQMPAFGATIPADQIASLVSWIYTPVVPAPSWAEADIRASRIE
HIDPASLPPKPVFDADPMNLFLVVETGDHHVSVLDGDKLEPIHRFQSRHALHGGPKFTAD
GRYVFFASRDGWITKYDLWNLKVITEIRAGINTRNVAVSPDGKHVAVANYLPNTLVLLDG
DLKLQKSIAVTDREGKTSSRVSAVYEATPRKSFVAALKDVPEVWEISFDPAAPEIPAGFI
HDYKYREGAFVAGYLNPRRTELADPLDDFFFTQDYSTVLGASREGVGQVVNLDVRRKIGD
LALDGMPHLGSGISWDWQGRRVMASTNLKAAEVTVIDLKDFSVIKRIPTRGPGFFLRSHE
NSRYAFVDSMMSREAKNILQVIDKQTLEIVKELKAPPGQTLAHVEFTRDGRYALASLSET
EGAIVVYDARSLEEVKRLPMNKPVGKYNVWNKTTRSEGTSH
Download sequence
Identical sequences H0Q2C6
WP_015437127.1.10474 gi|470171915|ref|YP_007552801.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]