SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|470171920|ref|YP_007552806.1| from Azoarcus sp. KH32C

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470171920|ref|YP_007552806.1|
Domain Number 1 Region: 23-400
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 2.35e-75
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|470171920|ref|YP_007552806.1|
Sequence length 403
Comment heme biosynthesis protein [Azoarcus sp. KH32C]
Sequence
MNRVREAMFRKLKTAVQIALPALLVAACSTAPAPSVRGTGDLGVVIERASGQIQVVETSG
RSRLAQVSGLGDLSHASVVFSRDGRYAYVFGRDGGLTKVDLLTATIARRVLQAGNSIGGA
ISQDGRLVVAQNYEPGGIKAFDAKTLELVADVPASYGADGKASKVVGLVDLPGNRFAYAL
FDANEIRVTDLSDPAHPKTERYPAGKQPYDALVTPDGRYYIAGLFGEDGLSMLDLWRPEQ
GVRTILPGYGRGEQALPVYKMPHLRGWAVAGGRAYLPAIGRHEVLVVDLATWQEVARIPV
KSQPVFVMARPDGREVWVNFAFPDNGWMQVIDTLTNRPVDTFQPGRAILHLEFTPRGEAV
WVSARDDDKVLIYDTRTHQKLAELPAASPSGIFFTSRAFRTGF
Download sequence
Identical sequences H0Q2D1
WP_015437132.1.10474 gi|470171920|ref|YP_007552806.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]