SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|470171923|ref|YP_007552809.1| from Azoarcus sp. KH32C

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470171923|ref|YP_007552809.1|
Domain Number 1 Region: 150-576
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 1.83e-123
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.00000000000636
Further Details:      
 
Domain Number 2 Region: 47-164
Classification Level Classification E-value
Superfamily Cytochrome c 2.58e-21
Family N-terminal (heme c) domain of cytochrome cd1-nitrite reductase 0.0000587
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|470171923|ref|YP_007552809.1|
Sequence length 576
Comment cytochrome cd1 nitrite reductase precursor [Azoarcus sp. KH32C]
Sequence
MSKHGKWLSGAMLLASLPLAISQAFADDAKKHVDEAEAKYQAGGSPLADVDLYKDSNPDA
PKMSKAEFDKARNIYFQRCAGCHGVLRKGATGKPLTPDITLSRGSEYLKVFIKYGSPAGM
PNWGTSGELSDDEVDLMARYVQQTPPQPPEFNMADMKSTWKVIIPPEQRPTKKMNNYNIA
NIFSTTLRDSGEIALIDGDTKKIINIIKTGYAVHISRISASGRYLFVIGRDARVNMVDLW
MEKPDNVAEIRIGLEARSVDTSKFKGFEDKLAIAGAYWPPQFVLMNGDTLEPLKIVSTRG
MTVDTQEYHPEPRVASIVASHFRPEFLVNVKETGKTLMVDYSDIKNLKMTEIGSARFLHD
GGWDLSKRYFLVAANQSNKVAAIDAKEGKLAGLIDVGKIPHPGRGANFVHPKYGPVWATG
HLGDDSIALVGTDPEKHKQYAWKMVDTLKSQGGGSLFIKTHPKSNHLYVDNPLHPESKVS
QSVAVYDLKNLQAGFKVLPIGDWAGLKDDGAKRVVQPEYNKNGDEVWFSVWSAKNKESAI
VVVDDKTLQLKTVIKDPKLITPTGHFNVYNTQHDVY
Download sequence
Identical sequences H0Q2D4
gi|470171923|ref|YP_007552809.1| WP_015437135.1.10474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]