SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170726687|ref|YP_001760713.1| from Shewanella woodyi ATCC 51908

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|170726687|ref|YP_001760713.1|
Domain Number - Region: 21-97
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00275
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|170726687|ref|YP_001760713.1|
Sequence length 221
Comment GAD-like domain-containing protein [Shewanella woodyi ATCC 51908]
Sequence
MNKFFDNFYNFAGFGPAVKSKQPTAEELEFFEDKLPNRLLEYWQEYGFCGWGEGLIWVVN
PADYADILMTWLSDTPFENADNYYVIARSAFGELIVWGEKTGQSIDINVNFGMIFPTDNT
EKLKKRGEERSIELFFASMSKDSLDKKDLDENPLFERAMAKLGPLEADEMYGFVPALAIG
GAPKLENLQKVKVLEHLTFLADLGEKTVMADIVAMSNALHK
Download sequence
Identical sequences B1KF77
WP_012324960.1.77901 gi|170726687|ref|YP_001760713.1| 392500.Swoo_2339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]