SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170727728|ref|YP_001761754.1| from Shewanella woodyi ATCC 51908

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170727728|ref|YP_001761754.1|
Domain Number 1 Region: 11-141
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 8.37e-28
Family SMI1/KNR4-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170727728|ref|YP_001761754.1|
Sequence length 144
Comment protein YobK [Shewanella woodyi ATCC 51908]
Sequence
MYISKLNNREGLWLAGGASLGLVSNLEEALGVILPETYKEFLLELGSLSIGDISISGITC
ENLDDGGGSVLSDTLYFQRDYDLPENLIVIQPDEDAPYCLDTTDKNSVGEMSVVCFEIQS
GEQNQIADNFQDWFFRYFLTNINR
Download sequence
Identical sequences B1KPX6
WP_012325994.1.77901 gi|170727728|ref|YP_001761754.1| 392500.Swoo_3391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]