SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170727753|ref|YP_001761779.1| from Shewanella woodyi ATCC 51908

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170727753|ref|YP_001761779.1|
Domain Number 1 Region: 34-429
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.58e-100
Family Amylase, catalytic domain 0.0000000000385
Further Details:      
 
Domain Number 2 Region: 602-697
Classification Level Classification E-value
Superfamily Starch-binding domain-like 1.99e-29
Family Starch-binding domain 0.0000444
Further Details:      
 
Domain Number 3 Region: 432-518
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 8.64e-27
Family alpha-Amylases, C-terminal beta-sheet domain 0.0000496
Further Details:      
 
Domain Number 4 Region: 523-594
Classification Level Classification E-value
Superfamily E set domains 0.000000000000171
Family E-set domains of sugar-utilizing enzymes 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|170727753|ref|YP_001761779.1|
Sequence length 703
Comment alpha amylase [Shewanella woodyi ATCC 51908]
Sequence
MTRLNSALRKPHLLPLLATLIATPSLASDTDVSNTVNYSTDVIYQIVTDRFLDGDSGNNP
PPAMLDSSCSNLKKYCGGDWQGIIDKLNDGYFSDMGITALWISQPVENIHGVLNDAQGST
SYHAYWARDFKRTNPYFGTFNRFDTLIQTAHNLGIKIIIDFAPNHSSPASSDDSSYAENG
RLYNDGVLMGGYSNDSANLFHHNGGTDFSTIEDGIYRNLFDLADFNHENQQMGQYLQEAI
ALWLDKGVDGIRVDAVKHMPLGWQKKWMSAIYKHKPVFSFGEWFLGSNEVDPANHDFANN
SGMSLLDFQFAQTTRKVFRDQTADMRALDQMIQATSSSYQEVIDQVTFIDNHDMDRFQQT
GVNQRRIEQALAFTLTSRGVPGIYYGTEQYLTGNGDPDNRAMMPNFNQTTTAYNVIKALA
PLRKSNPALAYGDTQERWSNSDVYVYERQFGSSVVLVAINRSSSQSYNLTGLFAALPQGN
YPDILSGKLNGNSIDVSANGAVTPFNLSSGEVGVWQYTASETQPKLGHVGPMMAAPGDTL
TLDGRGFGNTGAVQVGATNAQVLSWSDTQVKIQIPTISAGTYSVKLTTSNGQSSYPDLDV
LTGPQKSVRFILENGYTQWGEAIYLVGNTPELGSWDPNKAIGPFYNQVVEQYPNWYQDVS
VPTNTQLQFKFIKKNGNQVIWESGSNHQLSAGSTDSSIRVNWQ
Download sequence
Identical sequences B1KQS8
gi|170727753|ref|YP_001761779.1| 392500.Swoo_3416 WP_012326019.1.77901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]