SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170728418|ref|YP_001762444.1| from Shewanella woodyi ATCC 51908

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170728418|ref|YP_001762444.1|
Domain Number 1 Region: 13-166
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 3.92e-20
Family SMI1/KNR4-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|170728418|ref|YP_001762444.1|
Sequence length 183
Comment hypothetical protein Swoo_4093 [Shewanella woodyi ATCC 51908]
Sequence
MEKIDQLSAQIVWSPLDLEGGESREIYCASDKQLFDIEAFLGTSLPSDYKWFMKNYGMRI
IEDDRVNLNLNGVSMSFLSMFSAADDALIGTEMWSDSKNQSPRILPETLIIADSISNDLV
IMDLSETNYGKIYFISNLKAWGAFEDDDYMVLLAESFTELLSKIVHNENPTEPDFNIPDD
MIC
Download sequence
Identical sequences B1KH37
WP_012326678.1.77901 392500.Swoo_4093 gi|170728418|ref|YP_001762444.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]