SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170728939|ref|YP_001762965.1| from Shewanella woodyi ATCC 51908

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170728939|ref|YP_001762965.1|
Domain Number 1 Region: 33-104
Classification Level Classification E-value
Superfamily Coronavirus S2 glycoprotein 0.000022
Family Coronavirus S2 glycoprotein 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|170728939|ref|YP_001762965.1|
Sequence length 215
Comment hypothetical protein Swoo_4620 [Shewanella woodyi ATCC 51908]
Sequence
MKKHILMAIVSTSLLLSGCQSAYYGAMEKVGYHKRDIMVDRVTDAKESQEEAQEQFSSAL
EEMQALLNHDGGDLEKAYNKAKDEYESSQDAADDVSNRIEKVEDVADALFDEWQTEIGEI
SKASLRRNSESKLRETKRSYEQLVRTMKRAEGKMAPVLTAMKDNMLYLKHNLNAQAIGAI
KGEFASLQTDITGLIKEMNKSIDESTKFIASIEGK
Download sequence
Identical sequences B1KLZ0
392500.Swoo_4620 WP_012327195.1.29706 WP_012327195.1.77901 gi|170728939|ref|YP_001762965.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]