SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|390948929|ref|YP_006412688.1| from Thiocystis violascens DSM 198

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390948929|ref|YP_006412688.1|
Domain Number 1 Region: 49-103
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000000000213
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390948929|ref|YP_006412688.1|
Sequence length 105
Comment Kunitz/bovine pancreatic trypsin inhibitor-like protein [Thiocystis violascens DSM 198]
Sequence
MEGKTEVTMQGREREITMRILTIFAVFAIASTLSGCGSDHVLSNRDELPVECLAKPDPGS
CHAAQTKFYYDYREDRCKPFVYGGCKGRVPFQTMKDCSQYCVSGH
Download sequence
Identical sequences I3Y6E5
WP_014777061.1.4591 gi|390948929|ref|YP_006412688.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]