SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|295697078|ref|YP_003590316.1| from Kyrpidia tusciae DSM 2912

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|295697078|ref|YP_003590316.1|
Domain Number 1 Region: 216-384
Classification Level Classification E-value
Superfamily SIS domain 2.83e-35
Family mono-SIS domain 0.0002
Further Details:      
 
Domain Number 2 Region: 8-163
Classification Level Classification E-value
Superfamily SIS domain 7.12e-17
Family mono-SIS domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|295697078|ref|YP_003590316.1|
Sequence length 390
Comment phosphoheptose isomerase [Kyrpidia tusciae DSM 2912]
Sequence
MDPVERWAKERFQYRNDVSARFFPREAGRLAAACREMAERFLDGGRLIAIGRGPYATDAQ
HVSVEFVHPVIVGKRALPALDLSMAFPEWLNSVLRPEDMVMGFGAPGGDPAVAEALARAR
AGGAQTFALPGTEGSYAVDAPDSDPFVHQELIEILYHTLWETVHVFFEHRELGSGAGEAE
FLYPFLGSRRQDTSKVVAEVAESIEAKAREVERLRMQVAAEEMSNVVRAVHTLADCLAKG
GKLIVFGNGGSATDANDWALDMVLPPAGMRPHPAVSLSMEPAVLSALANDVGAEVMFVRQ
LIAHANREDVAVGISTSGGSKNILSALEEAKKRGLVTMALLGYDGGEVMRRGLADIAVIV
RSDYIPRIQEVQASVYHIIREGLEVVGNDA
Download sequence
Identical sequences D5WTD6
WP_013076455.1.77002 gi|295697078|ref|YP_003590316.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]