SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269838931|ref|YP_003323623.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269838931|ref|YP_003323623.1|
Domain Number 1 Region: 320-371,426-514,556-698
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.67e-28
Family Tandem AAA-ATPase domain 0.017
Further Details:      
 
Weak hits

Sequence:  gi|269838931|ref|YP_003323623.1|
Domain Number - Region: 49-103,130-215
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.00264
Family HD domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269838931|ref|YP_003323623.1|
Sequence length 944
Comment CRISPR-associated helicase Cas3 [Thermobaculum terrenum ATCC BAA-798]
Sequence
MNGGPGMDGTSEVDLSGAGSPVGAAGWRVDPWIFWAKWGSGPDLGWHPLLCHMLDVAAVT
LQMWRRVLPAAWKARISGVLGVGQEDAERWLAFFAGGHDIGKASPAFQLQLRPEQGRELV
ARRLRDAGLPLFNARAPHGTISANVLETVLADVFGLSGRSARWVAFAVGGHHGFVPSYDE
VRRDLDQQAVGWGMWDAAREVLLCRLADALGLPGSSRPTVESTPDAFMLAGLVSVADWIG
SNEEYFPYAAQSALQVPQLDAEAYLERAMRQAERAMASLGWVGWRPASGSMRLTELFPYI
RQPTTVQAAAEELAGEVKSPSITIIEAPMGEGKTEAAMLLADTFSTAHGMSGCYFALPTM
ATSNQMFGRVTDYLRHRYPEDVVVVNLVHGHSDLSALLQELRQKGEEIFQLQGVYDEALG
DEQLGAVVAGQWFTRGKRALLPPYGVGTVDQALLAVLQVKHVFVRLFALSTKTVIVDEVH
AYDVYMTTLLHRLLEWLGALSVPVVVLSATLPSARRRELVKAYARGAGWQAERDLPPAGY
PRITYAAAEDVRGIHFAPSEASRRKVALRWVSAPEHEALGQLLAEALSQGGCAAIICNTV
PRAQALYSALREVFPGLAEDGMPELDLLHARYPYEEREVREARTLGRFSRNGRRPHRAIL
VATQVIEQSLDLDFDLMVTDLAPVDLVLQRMGRLHRHPVHDPLRPERLRSPELWVVSPQV
MGDVPIFDRGSASVYDEHTLLRSWLALRDRDTLQLPEDIEELVEQVYSDGRVPQGASEEL
RSLWERTFKAQQKVLREDSLQAKYRYIKGPGYNSIWGIVTASVEEDAPELHPALQALTRL
AEPSVSAVCLVAGSGGPCLPDGTPVDLDTPPDAAMAERLLRRSVAITDARVLDPLLDVPV
PKGWERSSLLRGYRPLVFDASGRAMVGRWIVRIDPELGIVVESP
Download sequence
Identical sequences D1CGD0
gi|269838931|ref|YP_003323623.1| 525904.Tter_1895 WP_012875832.1.85100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]