SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269838949|ref|YP_003323641.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269838949|ref|YP_003323641.1|
Domain Number 1 Region: 34-300
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.11e-37
Family Glutaminyl-peptide cyclotransferase-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269838949|ref|YP_003323641.1|
Sequence length 304
Comment peptidase M28 [Thermobaculum terrenum ATCC BAA-798]
Sequence
MSHLDRRTFLWGLLGLAGAQLGCGAPGTATPTVGPLPFDRRRAWGYLLRQVAFGPRVPGT
APHSRCRDFLLRELRATLGSASPQAFSFQGVQMCNILSQYHGGGEDHVLLCAHWDTRPRA
DNERDPDRRRLPIPGANDGASGVAVLLEIAHALQVLRPPIRVSFALFDGEDWGPDEASMY
LGSRHYASTLPQGRPSWGVLLDMVGDRALRIPREGFSEEMARAVNDRVWAAARLAGHGDV
FVEERGASILDDHLPLLRRGIPVVDVIDFDYPHWHTLRDDPSACSPHSLEVVGRTVLAAL
TFEL
Download sequence
Identical sequences D1CGE8
WP_012875850.1.85100 525904.Tter_1913 gi|269838949|ref|YP_003323641.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]