SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269839000|ref|YP_003323692.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269839000|ref|YP_003323692.1|
Domain Number 1 Region: 84-220
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 5.23e-25
Family GntR ligand-binding domain-like 0.017
Further Details:      
 
Domain Number 2 Region: 12-108
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.45e-21
Family GntR-like transcriptional regulators 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269839000|ref|YP_003323692.1|
Sequence length 229
Comment GntR family transcriptional regulator [Thermobaculum terrenum ATCC BAA-798]
Sequence
MEAVLKVPPVGQPRRYRELVYASIKEAILQGQFAPGQPLVEEEIARSLNVSRTPVREALL
MLEHDGLIETKYGRGMYVRRLTREDFIDMFTANEVIEPYLARRACLYVTNDQIQQMEKVI
QMGEEAASNEDVPTFLRSGREFHALIGEAADNRSLAEVVNRNEEKTDLFLMAYGKCLDRE
CMFASNREHRLIMQALVRRDPDEAARLVLFHCQSVRHRFSPLFNHEEEG
Download sequence
Identical sequences D1CGJ9
gi|269839000|ref|YP_003323692.1| WP_012875901.1.85100 525904.Tter_1964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]