SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269839154|ref|YP_003323846.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269839154|ref|YP_003323846.1|
Domain Number 1 Region: 366-561
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.51e-57
Family Pyruvate oxidase and decarboxylase PP module 0.00037
Further Details:      
 
Domain Number 2 Region: 4-173
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.15e-50
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000404
Further Details:      
 
Domain Number 3 Region: 191-358
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 4.78e-39
Family Pyruvate oxidase and decarboxylase, middle domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269839154|ref|YP_003323846.1|
Sequence length 584
Comment thiamine pyrophosphate domain-containing TPP-binding protein [Thermobaculum terrenum ATCC BAA-798]
Sequence
MADTTADILVDRLVQWGVQVVFGLPGDGINGLMEALRKRQDDIKFVQVRHEESAAFAACG
YAKFTGRLGVCLATSGPGGIHLLNGLYDAKLDGAPVLAITGHTFHDLIGTHYQQDVDLDK
VFQDVAAYNERVMGPTHAINVLDEAVKTALAQHTVAHITVPKDIQDWEADDAHRSTANIP
EHSAELFAAARALPSEAELREAAEVINGGSKVAIFAGRGSVGARQELLELAEKVGGVIIK
PLLGKTSVPDDSPYTTGGIGLLGTAPSVDAVRECDTLLLVGTSFPYMEFYPKPGQARAVQ
IDIDPARIGLRYPVEVGLVGDSSEILRRLLPMVQPKEDKSFLRKAQKGMEDWRRLMKERG
TRADKPMKPEVVTHHLNKYLADDAIVISDTGTVTTWVARHIDARGSMQFSASGMLATMAN
GLPYAIGAATAFPHRQVVAIVGDGGFTMLMGDLATVAKYSLPVKVVIIKNNTLGQIKWEQ
IVLEGNPEYGNDLHPIDFELYARAVGVPAYTLEDPGDADELLRRAMAEPGPCLVQAVVDS
SEPPMPGNITLEQAVHFARSMLRGEKDRAEIIKTIIKDKVREVI
Download sequence
Identical sequences D1CH03
gi|269839154|ref|YP_003323846.1| 525904.Tter_2122 WP_012876055.1.85100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]