SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269839334|ref|YP_003324026.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269839334|ref|YP_003324026.1|
Domain Number 1 Region: 24-330
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 8.64e-114
Family Glycosyl hydrolases family 32 N-terminal domain 0.000000859
Further Details:      
 
Domain Number 2 Region: 334-491
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-24
Family Glycosyl hydrolases family 32 C-terminal domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269839334|ref|YP_003324026.1|
Sequence length 491
Comment sucrose-6-phosphate hydrolase [Thermobaculum terrenum ATCC BAA-798]
Sequence
MHNKYPDSIRRAEEARRQLEEQAVRSPWRQRYHFMPPAGWMNDPNGLIHYGGYYHLFYQH
NPFGPQWGPMHWGHARSRDLVHWEHLPIALAPSEPYDLHEQGGCFSGSAVESDGLLYLFY
TGCTFEDGQLRQSQCMAYSDDGVTFHKYPGNPVVPGPPPDGSPDFRDPKVWRHGDSWYMV
VGSCRDGRGKALLYRSGDLRRWRYVGVMAESDGSLGTMWECPDVFPLEDRWVLMFSPMGM
GETRGLYLVGDIDYERGRFLPERMGEMDCGFDFYAPQSLATPDGRRVLLGWANSWPWMPW
FSTFGPTAESGWCGALALPREVHLRADGTLRFPPLSELSSLRHERLFHGRMLLDHGRSLD
LPPSDDGCMELELEVDWPDGWGELEIALRATPDGARRTVLLCAADGAVTLDRDHADGYLR
GSRCGWRRRRGTLKLRIFVDASSVEVFVDEGDLVLSTNLYPPEDARLTTITARESRAEIR
RLNAWRMQQAW
Download sequence
Identical sequences D1CHI3
WP_012876235.1.85100 525904.Tter_2305 gi|269839334|ref|YP_003324026.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]