SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269839336|ref|YP_003324028.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|269839336|ref|YP_003324028.1|
Domain Number - Region: 115-155
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0206
Family Pyruvate oxidase and decarboxylase PP module 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269839336|ref|YP_003324028.1|
Sequence length 455
Comment Na+/H+ antiporter NhaA [Thermobaculum terrenum ATCC BAA-798]
Sequence
MGQTASEDFVQREQPIRKLLYPLLAFMGAQSSSGILLIACTVIALLWANSPWGHTYDAFW
HTKLVVGVGGYQLSLDLLHWINDGLMALFFFVVGLEIKRELLVGELSSLRQASLPIAAAV
GGMLAPAAIYTLFNWGGNGSHGWGIPMATDIAFALGVLSLLGSRIPNALKVFLTALAIVD
DIGAVLVIALFYTEDTSLRALLFASVVFLLLVACNVLHVRHPIPYALLGLVMWVAFLESG
VHASISGVLVALTIPARTRVDTKEFLDRTKELLEEFDAAGEEGESILTNAGQQAAIREIQ
ALSESAQTPMQRLDHMLHPWVAFAIMPVFALANAGVHLGGQIDLFSPVTLGVIAGLVLGK
QIGIFVASWGSARLGLADLPEDTSWRMVYGAGWLGGIGFTMSLFIATLAFGNDQRLLDDA
KVGILVGSLISGVFGLLYLRRVISRPTATAVTTTS
Download sequence
Identical sequences D1CHI5
525904.Tter_2307 gi|269839336|ref|YP_003324028.1| WP_012876237.1.85100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]