SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269839343|ref|YP_003324035.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269839343|ref|YP_003324035.1|
Domain Number 1 Region: 108-240
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.49e-22
Family GntR ligand-binding domain-like 0.018
Further Details:      
 
Domain Number 2 Region: 40-106
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000626
Family GntR-like transcriptional regulators 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269839343|ref|YP_003324035.1|
Sequence length 252
Comment GntR family transcriptional regulator [Thermobaculum terrenum ATCC BAA-798]
Sequence
MASIREDYTSSEGDAERRRAVEEMFDLLWGQNGKVYLPTAVDHAYQMIWIKLIGGEKRHG
ERLSDVDLAAELGLSRTPVRQALHRLAQDGLVRFDPRRGFSVREFTARDIREIFEVRAAL
EVLALRLGAHRLERPQLQFELAQLEHVRAHMDQNPIYLFLQNDLRMHNMIIRASGNSRLI
QILATIRSQHGLFQFRDSFYPGRILRALEDHERILLCLLDGDFGRAEEQLAQHIRNSMEG
ILVDLFGEGGEV
Download sequence
Identical sequences D1CHJ2
525904.Tter_2314 gi|269839343|ref|YP_003324035.1| WP_012876244.1.85100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]