SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269839435|ref|YP_003324127.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|269839435|ref|YP_003324127.1|
Domain Number - Region: 17-120
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0113
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269839435|ref|YP_003324127.1|
Sequence length 157
Comment hypothetical protein Tter_2410 [Thermobaculum terrenum ATCC BAA-798]
Sequence
MAQDIPGVAVRAFESQQLALDAVRALSDGGFSTEQISIVVPNPADPEQIPSEEEMEVGRM
GSLEVVTDENVPFGEGISVGSTGILVPNLGAVVGGPLAVAYAHQPDAAIDELLEDLGATD
EEIDEVEGAIAQGLTVVVVAAGSSRDEAQGILNKVGA
Download sequence
Identical sequences D1CHT4
gi|269839435|ref|YP_003324127.1| 525904.Tter_2410 WP_012876336.1.85100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]