SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269839453|ref|YP_003324145.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269839453|ref|YP_003324145.1|
Domain Number 1 Region: 302-354,385-546,583-653
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.09e-26
Family Tandem AAA-ATPase domain 0.072
Further Details:      
 
Weak hits

Sequence:  gi|269839453|ref|YP_003324145.1|
Domain Number - Region: 23-119
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.00549
Family MioX-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269839453|ref|YP_003324145.1|
Sequence length 858
Comment CRISPR-associated helicase Cas3 [Thermobaculum terrenum ATCC BAA-798]
Sequence
MKFIARPAETRGGREYPEELLADHLRVVAEAARGYLVGPWPDSERLSELAWVAGATHDFG
KYTTFFQEKLPPLEKPPPKPEYTHHAPVSALLGAYVCRQRWHSDREAALLVFLAIWRHHG
ALVCPSMILPGKQQLRDSPFYKRMIGGIKAEYEAIAAQIANMQGEHKGQIISEMSALGVP
EVEGFLSGDVVPGLMRDLYEAYMDLFFASEDPGAMRTYWHALLLFSALIDADKHISSRVG
TRDAPRYDIPYELVERYVQRMQREHQSVARAELLEIRDGVFQESTRFFEETPVEELFPGL
FSLTAPTGSGKTLAALGAALKLRERVRNTKGWTPRIIYALPFTNIIDQNHDVIQKVLSEL
PGYSSDPLGYLIKHHHLATIQGSKGSEEDVPTEEQLLMVESWDSEVVVTTFVQLFESMVT
NSNRRLKKLHNVAGSIIILDEIQSIPYEQWSLVHETITTLAQHLGCTVIQMTATRPRILP
EAREVLPQPDKYFGLLDRTQIVPRADVRSLEDLQDLVLELGERYHSVLVILNTIPSAVSF
YQQLTSLDGIEGYREPSELDRSKDDWDRYWDDYSPKGRMLVHLSTNVVPWQRRHRVVGLA
RILRRRKEELRPIVVSTQVVEAGVDLDFDVVVRDHAPLDSIVQAAGRCNRSWAADDQRPV
YVVGLRDERERHLAERIYGKVLTRKMEEVLSSPKDEPELYADIEQYFALLPDLLTDDEYR
AYIWAMRKLNFRGKEGEVSISQYRHIEEAGEAYPVIVELGEIGRRALKRLLEAREAYARV
SAASVDEKFRARTQLRNAYSCLGEFIITPYSYRLLANRPPRHSELEDHFYISTDDLAEYY
DLETGFRLDKMGDEAVML
Download sequence
Identical sequences D1CHV2
525904.Tter_2428 gi|269839453|ref|YP_003324145.1| WP_012876354.1.85100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]