SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269839555|ref|YP_003324247.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|269839555|ref|YP_003324247.1|
Domain Number - Region: 24-83
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.000955
Family LacY-like proton/sugar symporter 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269839555|ref|YP_003324247.1|
Sequence length 98
Comment hypothetical protein Tter_2536 [Thermobaculum terrenum ATCC BAA-798]
Sequence
MSDESTHQTAVAAESHAVEPGEGPPPGQGPLVLLALSIGMILMGIQLWLLTVALDLYLGG
SGRDVWQLAIVSGAIFLGGLGVIWLIRRRPRVRRRGGS
Download sequence
Identical sequences D1CI54
525904.Tter_2536 WP_012876456.1.85100 gi|269839555|ref|YP_003324247.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]