SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269839564|ref|YP_003324256.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269839564|ref|YP_003324256.1|
Domain Number 1 Region: 95-391
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.47e-20
Family TK-like PP module 0.025
Further Details:      
 
Domain Number 2 Region: 444-632
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000132
Family TK-like Pyr module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269839564|ref|YP_003324256.1|
Sequence length 815
Comment D-xylulose 5-phosphate/D-fructose 6-phosphate phosphoketolase [Thermobaculum terrenum ATCC BAA-798]
Sequence
MTQRRYAPEAIRVQEMAALYRQKSPDFAGWAAGYGVIEHTDLTQVRVWEMAQLLHARGVV
TAPEEVYRILAAADRITSAGMWLVVHSTYARNVYTDGRDLHAADFKPNPEGHTGGSLNMV
PAYVGYLAANAISRVTRAWLMGQGHCVAAIDSVNLLVGNMSHAHAERYDLSDAGLTRFVR
DFYAYTITPDGRPESPRGSHVNAHTAGGLMEGGYLGFAELQYVHMPLPGERLVAFLSDGS
FEEQRGSDWAPRWWRAEDCGLVCPIMIANGRRIDQRTTMAQQGGVEWFREHLRLNGFDPL
DIDGRDPAAFAWAILEMEERLTALAGAVREGEIRYPVPLPYAIAETIKGYGFPGEGTNLA
HNLPLGAIPAFDFEARSEFNAGARRLWVPLPEIERAVSILNNHELAHRPRERDNPLAKRH
VLAPDLPEPEWRDPSPEARVTPMAGIDAYFCRVLRANPELRPRVGNPDEMRSNRMHATLE
MLKHRVTDPEPHVPEAVDGKVITALNEEAVVSAALANKGGINLVVTYEAFAVKMLGAIRQ
ELIFARHQREAGYDPGWLSVPVVLTSHTWENAKNEQSHQDPTLAEALMGEMSDVSRVVFP
ADWNTASATLRAAYGTQGQIWAVVVPKNPVPVRFEPDEAAALIEHGAWRLRGKGDEEVLL
GAVGAYQLEQALLASRRLEARGIPHSVVYILEPGRFRTPRDSIEATHVASPETVVTLFPP
KAATRLFLVHMRPEPFLGTVRPLDTGPGRTRALGYINRGGTLSIDGMLFANRCTWAHALV
AIAEGLEIAPEELLDPAELAAVRGQGDPTVLMGER
Download sequence
Identical sequences D1CI63
WP_012876465.1.85100 525904.Tter_2545 gi|269839564|ref|YP_003324256.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]