SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269839682|ref|YP_003324374.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269839682|ref|YP_003324374.1|
Domain Number 1 Region: 101-146,239-507
Classification Level Classification E-value
Superfamily Pectin lyase-like 9.64e-38
Family Galacturonase 0.081
Further Details:      
 
Domain Number 2 Region: 784-852
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000292
Family Fibronectin type III 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269839682|ref|YP_003324374.1|
Sequence length 975
Comment hypothetical protein Tter_2664 [Thermobaculum terrenum ATCC BAA-798]
Sequence
MLCILNPNKVHADGGNQVSVYLARKPSQQLDILDATVDNSIVYANRQTFIIALIGEQILL
YRYCHGRLPYVLAGGLLLAAIVLLALLSNHQVTHAADCSQPLQELIDRAAPGAVVHVPPC
IYRETVVIDKPLTLEAEPGAEIRGSDVWTGWQRVGSLWVHGGAPDFPQEGWCSPGYQRCA
WPHQVFYDGKPLLQVAPTQTPQKGQFKVSGGKIFIADDPVGHTIEVTTRTQWVVGKADHV
TIRGFVMRHSASNDGLGAIANNSHSWWTLENNKLLYAHNAAVMLYRGSGHRVVNNEIAFC
GKMGLGARQISNSTIEGNRIHDNNTEMFHPQQVAAGMKTVILLNSVIRNNNVYSNNSPGI
WCDLDCQNVTIVGNRVHDNKWQGIWYELSSSAKIYDNVVWSNGWSHIGWGWGAGILVHNS
KRVEVYHNTVAWNRAGIWVKRQDRRGSAWHDPNWNHMFDIYIHDNWIISDSNKNNPTASG
WSDSFDGDLFNPANNNRGYHNLYWYPTREGLGPRFAWKAPLATLASYNRTPGEESARYMS
DSEKAQVLDSAHIPAPPDRTAPIGRVVIADGRGYTKFTTVSIALAATDPAGVALVRVSNI
PDSKNGLLAYAKTSGYSPNMQWSLTNTAYGGSNINGKRTVYVQWMDKLGNWSNIYSDQIF
LDTKAPIGAIHINSGDKYTKSRYVLLSATARDPSPGSGAYRVRFSNNARTWSKWRQFSGS
MSIKWTLIKGQGTRTVYVQYRDRAGNVLTTKDSILLDSMPPYTYRPWVGFVRNTPAASGV
PFKVGWREATDPAPASGVDRYIVQVSVNDGKWQSVDTTSGRSLPFTGSSGKHYRFRVRAI
DHAGNAGAYAYGTTFMARRIEDGSANIRYIRTWSKGSTSRYASTRGAAMVMRFWGTDVAW
IATKGPNRGKAAVYLDGVRVAVVNLYSSQLRGPSIVYAWSWDELGSHSIEIRVLGTHDIR
SKGNRVDIDALLTLK
Download sequence
Identical sequences D1CII1
525904.Tter_2664 gi|269839682|ref|YP_003324374.1| WP_012876583.1.85100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]