SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269839748|ref|YP_003324441.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269839748|ref|YP_003324441.1|
Domain Number 1 Region: 158-262
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.000000625
Family Serralysin-like metalloprotease, catalytic (N-terminal) domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269839748|ref|YP_003324441.1|
Sequence length 271
Comment hypothetical protein Tter_2731 [Thermobaculum terrenum ATCC BAA-798]
Sequence
MSEHLPGLWGGVYLGLILLACAGLWIALDRPAQANHAFDPWKHVESIHRPVGVLEYACAG
DTTELDDTAVRRRIINALKYDNPDLDWHLPKDDTWFPQGNDLISFYMWPQSCSWLATNDP
IAYENTPFRYRSRSLDDVRDACRSVGSVYACALWRDPVWVYNNQTPGTAHTDYRYFDIWM
WSELLDDANDAPYYGSPDGVTVRRAFVNHETGHALGLADPLRQPDGSYAPCSNDSIMHFP
APYCPNNSWFRQPQEADRRKVNWISINDSTP
Download sequence
Identical sequences D1CIP8
WP_012876649.1.85100 525904.Tter_2731 gi|269839748|ref|YP_003324441.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]