SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269839825|ref|YP_003324518.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269839825|ref|YP_003324518.1|
Domain Number 1 Region: 9-207
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.85e-67
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.0000124
Further Details:      
 
Domain Number 2 Region: 193-323
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 3.93e-34
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0000948
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269839825|ref|YP_003324518.1|
Sequence length 326
Comment transketolase [Thermobaculum terrenum ATCC BAA-798]
Sequence
MVAPATMEMSYKDALYEVLRSEMEADDSVVLIGEDFANGGAFGVAGDLLERFGPERVIRT
PISENSYVGVGVGAAMTGLRPVVEIMFMDFITLAMDQLVNHAAKIHYMYAGQYSVPIVVR
TPAGAGRGYGASHSQSLESWLIQVPGLKVVAPSSPADAGGLLRSAIWDPNPVVFIENKLL
YPKKGPVPEGIPPVPLGTAKVLRKGEDVTIATYGRMVEHALEAAAVLEPEGVSCEVIDLR
TLKPLDVTTLSRSFGRTHRLVCVEEGTGGVGAEVCSRLAETAGALGGRMIRVAAKDSPIP
SAGPLEARVVPQLEDIIEGCLSSLEG
Download sequence
Identical sequences D1CIX5
525904.Tter_2811 gi|269839825|ref|YP_003324518.1| WP_012876726.1.85100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]