SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269839864|ref|YP_003324557.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269839864|ref|YP_003324557.1|
Domain Number 1 Region: 399-567
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000206
Family Trypanosoma sialidase, C-terminal domain 0.052
Further Details:      
 
Domain Number 2 Region: 571-659
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000054
Family Fibronectin type III 0.0059
Further Details:      
 
Domain Number 3 Region: 112-349
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.00000397
Family beta-glycanases 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269839864|ref|YP_003324557.1|
Sequence length 664
Comment hypothetical protein Tter_2851 [Thermobaculum terrenum ATCC BAA-798]
Sequence
MVLLLALLCLPMWSGRASAASGEVLLVVDGGSKHYVDSRGLGYLLGDVELTSKWAVAFGR
RVLTSVEGRSDPRLGGFPYGVYGIDETDADRDMNYTDAGDVDPAALMADIASEGVYNVGV
SLSTGKVGVDKITRNLTYARKYGLKLIVRSLAVDTTGEMDTTRTRESLARFQQVFREHPE
LRAQVYAFITYLEPMGDRVPLTELQAAYRLHKSVFPNIPVMAVFNQRFNVADSNHDGISD
GALGQPLNPYGPNVADIVALDVYPVLPDSYGYDTISRQYVHARRVVDRVDAQTGKRTPIW
AFAQAHALNIDPNDRPEPHQLYRQVNDWLRAGPEAGLRGVDGLIWYAWHFTSGREQSHVD
LEDVPANREMARLIGQQLKASRFVTHDLPYSSELMVEPGKYLRVRSSGHINLSAGTITLA
IGHQWPGNDGRAHVLLDTGGSSTRNRLRIEKTSTNVLRLVITDRYGRTKWVGMNVGDANM
PGKRYWPGYSEIAATWSNGAMAIYLDGVRGGLSGGNGTGQLSGVGEYIYLGASLSGGSSA
EGTLRHITIRSAAGTATEVRRWTLYAPLAQLPGRPTSLWPSATTITDPTPTLRWGDSPSA
TTYEVQVSRSSGFGTVLLSREITSTNWTTPSSRPLTRGMRYYWRVRAKDRYGMGPWATAS
FYLK
Download sequence
Identical sequences D1CJ14
gi|269839864|ref|YP_003324557.1| WP_012876764.1.85100 525904.Tter_2851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]