SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269925133|ref|YP_003321756.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269925133|ref|YP_003321756.1|
Domain Number 1 Region: 12-144
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.48e-19
Family HD domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269925133|ref|YP_003321756.1|
Sequence length 190
Comment metal dependent phosphohydrolase [Thermobaculum terrenum ATCC BAA-798]
Sequence
MNRQEAWELLNEYVKSPNLIRHCLAVEAAVRGYARLYGEDEELWGLAGLLHDFDYEIHPT
LDQHPSMGKPILEARGVPQEVIYAIQSHSDFTGVPRVHLLDKVLYASDEISGFIVAVALV
KPSRSIHEVDVKSVKKKLKDKAFARNVNRDDIYRGAEELGVDLDTHIANVIEFLKPISDE
LTPKEQNVSR
Download sequence
Identical sequences D1CDC8
525904.Tter_0010 WP_012873969.1.85100 gi|269925133|ref|YP_003321756.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]