SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269925214|ref|YP_003321837.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269925214|ref|YP_003321837.1|
Domain Number 1 Region: 20-341
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.05e-105
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.000000314
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269925214|ref|YP_003321837.1|
Sequence length 344
Comment 3-methyl-2-oxobutanoate dehydrogenase [Thermobaculum terrenum ATCC BAA-798]
Sequence
MATTQDEISATNSQDRHTELGLTAEDLKKMYRLMVLARTLDERMWILNRQGKVHFVISGQ
GQEGAQIGTAYALRPGVDFFVPYYRDLTVCLYAGVTPREIMLSLFARADDPASGGRQMPG
HYSYKPLKIVTGSSPIATQIPHAVGIALASKIKNEDVVTAVWFGEAASSKGDFHEGLNFA
GVIKAPVIFICENNHYAISVPQNKQMAVPNVADKACAYGFPGVVTDGNDVLDVYKAMKAA
VERARAGEGPTLIECKTYRIVPHSSDDDESRYRTKVEVEEWKRKGPIERLRTYMQAQGIW
SEEFENQVKSEALSIVDDATRFAEQASPPSPSSLLRHVFAEEAK
Download sequence
Identical sequences D1CDK9
gi|269925214|ref|YP_003321837.1| 525904.Tter_0093 WP_012874050.1.85100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]