SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269925223|ref|YP_003321846.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269925223|ref|YP_003321846.1|
Domain Number 1 Region: 11-57
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000314
Family Homodimeric domain of signal transducing histidine kinase 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269925223|ref|YP_003321846.1|
Sequence length 78
Comment hypothetical protein Tter_0102 [Thermobaculum terrenum ATCC BAA-798]
Sequence
MEMIPREKYYHEVRTQLTRAILAAQLLKRGGLQNLDARQVRLLHTLEDSLMRASWLIMTH
KINNIGSHRPASSKYRHN
Download sequence
Identical sequences D1CDL8
gi|269925223|ref|YP_003321846.1| 525904.Tter_0102 WP_012874059.1.85100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]