SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269925260|ref|YP_003321883.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269925260|ref|YP_003321883.1|
Domain Number 1 Region: 10-351
Classification Level Classification E-value
Superfamily SIS domain 4.82e-57
Family double-SIS domain 0.0000363
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269925260|ref|YP_003321883.1|
Sequence length 354
Comment glutamine--fructose-6-phosphate transaminase (isomerizing) [Thermobaculum terrenum ATCC BAA-798]
Sequence
MLETSTAHSHTYNEITNQPVSWKTTVDAISSQWAELQPQLTITPDTHYVFVGCGTSLYIA
QSAAQCFQEITGYTSLAVPGSEVFLSAKSTVPSRYPVIAFIISRSGTTTEALLAADYLAA
NRSNVTTIGITCNSDTELTKRTRFSIQLPHAHEESVVMTQSFTSMLIALQYVAASLAGDQ
MVIDQISSLSTYLQRDIRSFESKAQELGENLNLDHFVYLGLGPNYGLAQEGNLKLKEMTQ
VHCEAYNPLEFRHGPISTVREGSAIILLAGNRERDYVPSLVTDLKEVGAFVASCSPYPID
GSDMHLLVGKELTDVPRCALYMPFLQYLAYYRAVSLGLNPDQPRNLSQVVKLDE
Download sequence
Identical sequences D1CDQ5
WP_012874096.1.85100 gi|269925260|ref|YP_003321883.1| 525904.Tter_0139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]