SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269925279|ref|YP_003321902.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269925279|ref|YP_003321902.1|
Domain Number 1 Region: 101-446
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 7.45e-35
Family Soluble quinoprotein glucose dehydrogenase 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269925279|ref|YP_003321902.1|
Sequence length 450
Comment Glucose/sorbosone dehydrogenase-like protein [Thermobaculum terrenum ATCC BAA-798]
Sequence
MVAQKITFTLALILVLLVTACGGEQQSPTSTQTVISPSPSVAPTSPSANNPSSTPTPIAA
SQSPPTPVATEETTKPSQEPAKETTPNPIPSATQEREVNRNVRVGIRQIASGFDQPLFVT
YANDNSNRLFVVEKGGKIKFLDGRVFLDITNRVGSGGSEQGLLGLAFHPNYRVNRRFFVN
YTDLNGNTVVAEFRAIDNGRRADPNSEKVILRQEQPAANHNGGMLAFGPDGYLYIALGDG
GGANDTYGNGQNLNTLLAKILRIDVDRGNPYSIPKDNPFVGRDNARPETWAWGLRNPWRF
SFDRQTGDLYIADVGQNQWEEINYQRAGSKGGQNYGWPIMEGRHCLSSSQCNQEGLTLPV
AEYSHELGCSVTGGYVYRGKRFPALRGKYFFGDYCTGRIWSLQRAENSNWVMKEETDTDL
SISSFGEDKNGEIYITDLAGGGIYMLVASS
Download sequence
Identical sequences D1CDS4
WP_012874115.1.85100 gi|269925279|ref|YP_003321902.1| 525904.Tter_0158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]